Search results for " Proton"

showing 10 items of 178 documents

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Characterization of a proton pump from Acer pseudoplatanus cell microsomes

1985

Abstract An Acer pseudoplatanus cell microsomal fraction was enriched in ATPase by sedimentation through a sucrose cushion and treatment with Triton X-100. This activity, which reached 0.9 μmol P i min −1 mg −1 protein, was specific for ATP, slightly stimulated by K + , inhibited by orthovanadate and diethylstilbestrol, insensitive to oligomycin and azide, and had a K m - value of 0.51 mM for MgATP. ATP-dependent proton translocation was demonstrated by the ΔpH probe acridine orange. This activity had a optimum at pH 6.5, was substrate specific for ATP, and was strongly dependent on K + . Preparations of plasma membrane ATPase from A. pseudoplatanus cell culture thus posses biochemical prop…

0106 biological sciencesOligomycinATPaseDiaphragm pumpPlant ScienceBiology01 natural sciences[SDV.GEN.GPL]Life Sciences [q-bio]/Genetics/Plants genetics03 medical and health scienceschemistry.chemical_compound[SDV.GEN.GPL] Life Sciences [q-bio]/Genetics/Plants geneticsProton transportGenetics030304 developmental biologychemistry.chemical_classification0303 health sciencesAcridine orangeERABLE FAUX PLATANEGeneral MedicinePOMPE PROTONAcer pseudoplatanusbiology.organism_classificationEnzymeBiochemistrychemistrybiology.proteinMicrosomeAgronomy and Crop Science010606 plant biology & botanyPlant Science
researchProduct

Distinct lytic vacuolar compartments are embedded inside the protein storage vacuole of dry and germinating Arabidopsis thaliana seeds.

2011

International audience; Plant cell vacuoles are diverse and dynamic structures. In particular, during seed germination, the protein storage vacuoles are rapidly replaced by a central lytic vacuole enabling rapid elongation of embryo cells. In this study, we investigate the dynamic remodeling of vacuolar compartments during Arabidopsis seed germination using immunocytochemistry with antibodies against tonoplast intrinsic protein (TIP) isoforms as well as proteins involved in nutrient mobilization and vacuolar acidification. Our results confirm the existence of a lytic compartment embedded in the protein storage vacuole of dry seeds, decorated by γ-TIP, the vacuolar proton pumping pyrophospha…

0106 biological sciencesPhysiologyProtein storage vacuoleProton-pumping pyrophosphataseArabidopsisPlant ScienceVacuoleUNIQUEMESH: Protein Isoforms01 natural sciencesPYROPHOSPHATASEArabidopsisProtein IsoformsMESH: ArabidopsisH+-ATPASETONOPLAST INTRINSIC PROTEINPLANT-CELLSCation Transport ProteinsIN-VIVOPlant Proteinschemistry.chemical_classification0303 health sciencesMESH: Plant ProteinsGeneral MedicineCell biologyProtein TransportVacuolar acidificationLytic cycleSeedsPREVACUOLAR COMPARTMENTMESH: DesiccationVacuolar Proton-Translocating ATPasesMESH: Protein TransportMESH: Vacuolar Proton-Translocating ATPasesGerminationMESH: Arabidopsis ProteinsMESH: GerminationBiologyAquaporinsMESH: Vacuoles03 medical and health sciencesMESH: AquaporinsMESH: Cation Transport ProteinsStorage protein[SDV.BV]Life Sciences [q-bio]/Vegetal BiologyLytic vacuoleDesiccation030304 developmental biologySeedArabidopsis ProteinsCell Biologybiology.organism_classificationTRANSPORTchemistryMESH: SeedsVacuolesVacuoleMEMBRANEMOBILIZATION010606 plant biology & botany
researchProduct

Low-Power, Subthreshold Reference Circuits for the Space Environment : Evaluated with -rays, X-rays, Protons and Heavy Ions

2019

The radiation tolerance of subthreshold reference circuits for space microelectronics is presented. The assessment is supported by measured results of total ionization dose and single event transient radiation-induced effects under &gamma

02 engineering and technologyHardware_PERFORMANCEANDRELIABILITYgammasäteily7. Clean energy01 natural sciencesanalog single-event transient (ASET)Ionizationsingle-event effects (SEE)0202 electrical engineering electronic engineering information engineeringAnnan elektroteknik och elektronikElectronic circuitPhysicsprotonsSubthreshold conductionionisoiva säteilyröntgensäteilyGamma raygamma-raysHardware and ArchitectureAtomic physicsVoltage referencemikroelektroniikkaprotonitComputer Networks and Communicationslcsh:TK7800-8360voltage referenceIonheavy-ions0103 physical sciencesionizationradiation hardening by design (RHBD)X-raysHardware_INTEGRATEDCIRCUITSMicroelectronicsElectrical and Electronic Engineeringhiukkassäteilybandgap voltage reference (BGR)Other Electrical Engineering Electronic Engineering Information Engineering010308 nuclear & particles physicsbusiness.industry020208 electrical & electronic engineeringlcsh:Electronicsspace electronicstotal ionization dose (TID)Analog single-event transient (ASET); Bandgap voltage reference (BGR); CMOS analog integrated circuits; Gamma-rays; Heavy-ions; Ionization; Protons; Radiation hardening by design (RHBD); Reference circuits; Single-event effects (SEE); Space electronics; Total ionization dose (TID); Voltage reference; X-raysmikropiiritsäteilyfysiikkaControl and Systems Engineeringreference circuitsSignal ProcessingbusinessSpace environmentHardware_LOGICDESIGNCMOS analog integrated circuits
researchProduct

Methylmercury-induced developmental toxicity is associated with oxidative stress and cofilin phosphorylation. Cellular and human studies

2017

Environmental exposure to methylmercury (MeHg) during development is of concern because it is easily incorporated in children’s body both pre- and post-natal, it acts at several levels of neural pathways (mitochondria, cytoskeleton, neurotransmission) and it causes behavioral impairment in child. We evaluated the effects of prolonged exposure to 10–600 nM MeHg on primary cultures of mouse cortical (CCN) and of cerebellar granule cells (CGC) during their differentiation period. In addition, it was studied if prenatal MeHg exposure correlated with altered antioxidant defenses and cofilin phosphorylation in human placentas (n = 12) from the INMA cohort (Spain). Exposure to MeHg for 9 days in v…

0301 basic medicineDevelopmental DisabilitiesGlutathione reductaseCiencias de la SaludMitochondrionMETHYLMERCURYToxicologymedicine.disease_causeProtein CarbonylationMiceCytosolMITOCHONDRIAPregnancyPhosphorylationOXIDATIVE STRESSCells Culturedchemistry.chemical_classificationNeuronsbiologyGeneral NeuroscienceGlutathione peroxidaseCOFILINBrainMethylmercuryEnvironmental exposureCofilinMethylmercury CompoundsMitochondrial Proton-Translocating ATPasesGlutathioneCell biologyMitochondriaGlutathione ReductaseActin Depolymerizing FactorsCofilinPhosphorylationFemaleHuman placentaactinCortactinCIENCIAS MÉDICAS Y DE LA SALUDmacromolecular substancesACTIN03 medical and health sciencesCultured neuronsmedicineAnimalsHumansCULTURED NEURONSGlutathione PeroxidaseSalud OcupacionalHUMAN PLACENTAMolecular biology030104 developmental biologychemistryAnimals NewbornOxidative stressbiology.proteinOxidative stress
researchProduct

Actin Filaments Are Involved in the Coupling of V0-V1 Domains of Vacuolar H+-ATPase at the Golgi Complex*

2016

We previously reported that actin-depolymerizing agents promote the alkalization of the Golgi stack and the trans-Golgi network. The main determinant of acidic pH at the Golgi is the vacuolar-type H+-translocating ATPase (V-ATPase), whose V1 domain subunits B and C bind actin. We have generated a GFP-tagged subunit B2 construct (GFP-B2) that is incorporated into the V1 domain, which in turn is coupled to the V0 sector. GFP-B2 subunit is enriched at distal Golgi compartments in HeLa cells. Subcellular fractionation, immunoprecipitation, and inversal FRAP experiments show that the actin depolymerization promotes the dissociation of V1-V0 domains, which entails subunit B2 translocation from Go…

0301 basic medicineVacuolar Proton-Translocating ATPasesGolgi ApparatusBiologyMicrofilamentBiochemistry03 medical and health sciencessymbols.namesakeCytosolHumansActin-binding proteinMolecular BiologyLipid raftActinGolgi membraneCell BiologyIntracellular MembranesGolgi apparatusHydrogen-Ion ConcentrationActin cytoskeletonCell biologyProtein Structure TertiaryCytosolActin Cytoskeleton030104 developmental biologysymbolsbiology.proteinHeLa Cells
researchProduct

Whole genome semiconductor based sequencing of farmed European sea bass (Dicentrarchus labrax) Mediterranean genetic stocks using a DNA pooling appro…

2016

European sea bass (Dicentrarchus labrax) is an important marine species for commercial and sport fisheries and aquaculture production. Recently, the European sea bass genome has been sequenced and assembled. This resource can open new opportunities to evaluate and monitor variability and identify variants that could contribute to the adaptation to farming conditions. In this work, two DNA pools constructed from cultivated European sea bass were sequenced using a next generation semiconductor sequencing approach based on Ion Proton sequencer. Using the first draft version of the D. labrax genome as reference, sequenced reads obtained a total of about 1.6 million of single nucleotide polymorp…

0301 basic medicinefood.ingredientIon ProtonSNPBiologyAquatic ScienceGenomePolymorphism Single NucleotideCultivated sea baDNA sequencing03 medical and health sciencesBass (fish)Settore AGR/17 - Zootecnica Generale E Miglioramento Genetico0302 clinical medicinefoodChromosome regionsNext generation sequencingCultivated sea bass Next generation sequencing Ion Proton SNPGeneticsAnimalsSea bassGeneGeneticsGenomeCultivated sea bass; Ion Proton; Next generation sequencing; SNP; Aquatic Science; GeneticsHigh-Throughput Nucleotide SequencingIon semiconductor sequencingSequence Analysis DNA030104 developmental biologyItalyBassSelective sweepCultivated sea bass030217 neurology & neurosurgery
researchProduct

Caracterización de protones acelerados por láser y estudio de aplicaciones médicas

2017

El desarrollo de técnicas de amplificación láser durante las últimas décadas [1] ha derivado en una tecnología capaz de generar pulsos ultracortos, decenas de femtosegundo, y ultraintensos, en el orden del terawatio-petawatio. Estos pulsos pueden ser utilizados como vehículo para la aceleración de partículas hasta energías multi-MeV [2]. Esto ha generado un gran interés de la comunidad científica por la posibilidad de utilizar esta tecnología, que podría tener virtudes frente a los mecanismos de aceleración convencionales, además de ser un terreno inexplorado. El objetivo principal es el diseño de un experimento, detectores de partículas, y todos los periféricos necesarios para demostrar la…

:FÍSICA [UNESCO]física nuclearUNESCO::FÍSICAlaseres ultracortos y ultraintensosaceleracion de protones por laser
researchProduct

Nuclear structure studies on quadrupole and octupole correlations in the vicinity of heavy N=Z nuclei with agata and neda

2022

La evolución de la colectividad es esencial para comprender la estructura de los núcleos alejados de la estabilidad. La región que se encuentra justo por encima de la capa cerrada Z=50, en las proximidades de N=Z, presenta interesantes propiedades colectivas de carácter cuadrupolar y octupolar. El objetivo de esta tesis es estudiar la evolución de la colectividad cuadrupolar y octupolar en isótopos ligeros de Xe, al acercarse a la línea N=Z, mediante la medida de la vida media de los estados excitados de baja energía del 112Xe, para las transiciones que desexcitan dichos estados se han determinado las probabilidades de transiciones reducidas. Partiendo del núcleo semimágico 136Xe, a medida …

:FÍSICA::Física atómica y nuclear [UNESCO]UNESCO::FÍSICA::Física atómica y nuclearcolectividad nuclearvida media de los estados nuclearesnúcleos ricos en protonesdetectores de centelleo y de germanioestructura nuclear
researchProduct

Observation and Measurement of Forward Proton Scattering in Association with Lepton Pairs Produced via the Photon Fusion Mechanism at ATLAS

2020

The observation of forward proton scattering in association with lepton pairs (eþe− þ p or μþμ− þ p) produced via photon fusion is presented. The scattered proton is detected by the ATLAS Forward Proton spectrometer, while the leptons are reconstructed by the central ATLAS detector. Proton-proton collision data recorded in 2017 at a center-of-mass energy of ffiffiffi s p ¼ 13 TeV are analyzed, corresponding to an integrated luminosity of 14.6 fb−1. A total of 57 (123) candidates in the ee þ p (μμ þ p) final state are selected, allowing the background-only hypothesis to be rejected with a significance exceeding 5 standard deviations in each channel. Proton-tagging techniques are introduced f…

:Kjerne- og elementærpartikkelfysikk: 431 [VDP]Photon13000 GeV-cmsLHC ATLASmeasured [channel cross section]General Physics and Astronomy01 natural sciences7. Clean energyHigh Energy Physics - Experimentelectron: pair productionSubatomär fysikHigh Energy Physics - Experiment (hep-ex)Integrated LuminosityFusion Mechanismphoton photon: fusionspectrometer [p]Subatomic Physics[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]scattering [p p]pair production [lepton]Electroweak interactionQuantum ChromodynamicsParticle productionNuclear ExperimentSettore FIS/01PhysicsQuantum chromodynamicsObservation and MeasurementQuantum electrodynamicsLarge Hadron Colliderp: spectrometerdimuonAtlas (topology)COLLISIONS; PHYSICS; GAMMA; LIGHT; LHCElectroweak interactionDetectorphotonATLASfusion [photon photon]muon: pair production:Nuclear and elementary particle physics: 431 [VDP]PhotoproductionLIGHTCERN LHC CollATLAS DetectorsLHCcolliding beams [p p]channel cross section: measuredParticle Physics - Experimentsmall-angleParticle physicsp p: scatteringCOLLISIONSp: particle identificationCiências Naturais::Ciências Físicas530 Physicslepton: pair production:Ciências Físicas [Ciências Naturais]Particles & FieldsFOS: Physical sciencesparticle identification [p]LHC ATLAS High Energy PhysicsPHYSICS0103 physical sciencesddc:530Cross-Section Measurementpair production [electron]pair production [muon]High Energy Physics010306 general physicsCiencias ExactasATLAS CollaborationScience & TechnologySpectrometerhep-exPomeronsFísicaGAMMALeptonsProton Scatteringexclusive productionPrecision measurementsProton Proton CollisionsStandard DeviationExperimental High Energy PhysicsElementary Particles and FieldsHigh Energy Physics::ExperimentHadron-hadron collisionsp p: colliding beamsLeptonacceptanceexperimental results
researchProduct